top of page

CircRNA

Gene

chr4|40119931|40122309|+|1|circRNA|N4BP2|ENST00000261435.10|9

N4BP2

Open Reading Frame (ORF)

LTQIVLWREYHLVLAVVKIIKKTVILQIVDHFKMKNPHLVK

Peptide

LTQIVLWR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page