top of page

CircRNA

Gene

chr4|3316069|3318051|+|1|circRNA|RGS12|NM_002926|2

RGS12

Open Reading Frame (ORF)

LKYGSKGTMRRALGLGSSSECLELGRPPNAHCLGRRPQGCGVWRLPGGGPATDSRFRDRHPVCSAAS

Peptide

ALGLGSSSECLELGRPPNAHCLGR

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page