top of page

CircRNA

Gene

chr4|3103823|3115445|+|4|circRNA|HTT|NM_002111|4,5,6,7

HTT

Open Reading Frame (ORF)

LLKAFIANLKSSSPTIRRTAAGSAVSICQHSRRTQYFYSWLLNVLLGFDGF

Peptide

TQYFYSWLLNVLLGFDGF

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page