top of page

CircRNA

Gene

chr4|185611779|185630598|-|8|circRNA|SORBS2|ENST00000418609.5|12,11,10,9,8,7,6,5

SORBS2

Open Reading Frame (ORF)

LIKTGMKVKSQEPTDKASSLFPMWRSSRRTQKVLRTTLTLQYPTAILVIGFTA

Peptide

LIKTGMK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page