top of page

CircRNA

Gene

chr4|185429333|185445130|+|4|circRNA|C4orf47|ENST00000508698.3|2,3,4,5

C4orf47

Open Reading Frame (ORF)

LILTHHILLTLMWLNWQIFLAKMIRFSTHQVDQKADQLKV

Peptide

MIRFSTHQVDQK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page