top of page

CircRNA

Gene

chr4|1723420|1728787|+|3|circRNA|TACC3|NM_006342|2,3,4

TACC3

Open Reading Frame (ORF)

MTQTSSRSEVTPSLVAVRPSPQKALRPGWASQRLNSCMLGLPRRSQVPV

Peptide

MTQTSSRSEVTPSLVAVRPSPQK

ORF Found in Long-Read

true

Peptide Length

23

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

23

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page