top of page

CircRNA

Gene

chr4|151716008|151719538|-|3|circRNA|GATB|ENST00000263985.10|5,4,3

GATB

Open Reading Frame (ORF)

LEVVLEPDMSCGEEAATAVRELQLILQALGTSQANMAGSQQEVCRSGGDDRPGSELPHKQEVLV

Peptide

LEVVLEPDMSCGEEAATAVRELQLILQALGTSQANMAGSQQEVCR

ORF Found in Long-Read

false

Peptide Length

45

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

38

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page