top of page

CircRNA

Gene

chr4|150806270|150831976|-|5|circRNA|LRBA|ENST00000510413.5|33,32,31,30,29

LRBA

Open Reading Frame (ORF)

LEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTRG

Peptide

EIFVDFAPFLSRTLLGSHGQELLIEGTR

ORF Found in Long-Read

false

Peptide Length

28

Stop Codon

TAG

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

27

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page