top of page

CircRNA

Gene

chr4|1212912|1228343|-|6|circRNA|CTBP1|NM_001012614|9,8,7,6,5,4

CTBP1

Open Reading Frame (ORF)

LSSMGLPIGPERGCGGPDVPHHHSHQGGPGEVQSPPHHRPDWQWF

Peptide

LSSMGLPIGPER

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page