top of page

CircRNA

Gene

chr3|58156075|58159544|+|1|ciRNA|FLNB|ENST00000490882.5|42

FLNB

Open Reading Frame (ORF)

LTTDVTQSLGSFPVAESTPHTLRADDTWGEQKQSHSQQHTLMFGDTFVFKGLFKRNKGSLFITG

Peptide

GSLFITG

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page