top of page

CircRNA

Gene

chr3|58130740|58136168|+|5|circRNA|FLNB|ENST00000490882.5|25,26,27,28,29

FLNB

Open Reading Frame (ORF)

LESPTGVTTSHFLLIASEPHRRVMPASAWPRAAPSGFL

Peptide

VMPASAWPRAAPSGFL

ORF Found in Long-Read

true

Peptide Length

16

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page