top of page

CircRNA

Gene

chr3|52943352|52969258|-|3|circRNA|SFMBT1|NM_016329|4,3,2

SFMBT1

Open Reading Frame (ORF)

LRPTGLPPLSLPVSSCSFSAMMAMGRIGEQISGVTSGRLISTPLGGVSRIRRPLKPQKHFHLDPWIPIEQMLETCK

Peptide

LISTPLGGVSRIR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page