top of page

CircRNA

Gene

chr3|51419733|51422431|-|2|circRNA|VPRBP|ENST00000423656.5|14,13

VPRBP

Open Reading Frame (ORF)

LRVSSSSMMLKFRSQHFRLSSIVCVAQITEYPVLVNLSLVLLGESCLRTLKAVSTPWPRCGMWFSPTTASRCSCPYCPLRCPSQMQTKSGPWPAKP

Peptide

LRVSSSSMMLK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page