top of page

CircRNA

Gene

chr3|42528123|42530943|+|1|ciRNA|VIPR1|ENST00000446673.5|5

VIPR1

Open Reading Frame (ORF)

LQVGCKAAMVFFQYCVMANFFWLLVEGLYLYTLLAVSFFSERKYFWGYILIGWGMVPVRILALAHLPQSRRYL

Peptide

ILALAHLPQSR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page