top of page

CircRNA

Gene

chr3|37294978|37302332|+|5|circRNA|GOLGA4|ENST00000361924.6|6,7,8,9,10

GOLGA4

Open Reading Frame (ORF)

MVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQGEELREQKEKSERAGAPNGPAGKETSARGV

Peptide

AGAPNGPAGKETSAR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page