top of page

CircRNA

Gene

chr3|24143500|24146822|-|2|circRNA|THRB|NM_000461|7,6

THRB

Open Reading Frame (ORF)

LSPKPMWRPTPKAATGSKNGNSWVSLEEPFRKISIHPIPVNMKENVS

Peptide

NGNSWVSLEEPFR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page