top of page

CircRNA

Gene

chr3|197814907|197817302|+|2|circRNA|LRCH3|NM_032773|2,3

LRCH3

Open Reading Frame (ORF)

LSTLPVHLCNLPLKVLIASNNKLVSLPEEIGHLRHLMELTCREIAFQKFL

Peptide

HLMELTCR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page