top of page

CircRNA

Gene

chr3|188524664|188609844|+|2|circRNA|LPP|ENST00000448637.5|5,6

LPP

Open Reading Frame (ORF)

LPLHQDKFMAQGPRAITLSQFLSLGSVHLLQHGEAWIMPTFHHQDFSRSLGMGMPPTRDAIMKATMQQGQAMGAEMTLTLPMVNKVTQIPGNGNQGTLLLEQGTRTLLGCIQSLVPRRPISQILFQPPVRHHCSQRGIPEARHLRRGAPAWTLRLTP

Peptide

GIPEARHLR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page