top of page

CircRNA

Gene

chr3|184824544|184855818|+|12|circRNA|VPS8|ENST00000287546.8|2,3,4,5,6,7,8,9,10,11,12,13

VPS8

Open Reading Frame (ORF)

MDPSSVPLLAWHFVAVQNYVNPMLAFCRGDVVHFLLR

Peptide

GDVVHFLLR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page