top of page

CircRNA

Gene

chr3|179706933|179708957|+|2|circRNA|USP13|ENST00000263966.7|5,6

USP13

Open Reading Frame (ORF)

LRENLWLNLTDGSVLCGKWFFDSSGGNGHALEHYRDMGYPLAVKLGTITPDGAGNNCL

Peptide

LGTITPDGAGNNCL

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page