top of page

CircRNA

Gene

chr3|172112451|172251541|+|5|circRNA|FNDC3B|ENST00000415807.6|2,3,4,5,6

FNDC3B

Open Reading Frame (ORF)

MAMGRAIVVEVAEAAAVVVPELRKQSDEQEAAQSRMIQTCKEAS

Peptide

AIVVEVAEAAAVVVPELR

ORF Found in Long-Read

true

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116,PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page