top of page

CircRNA

Gene

chr3|168029103|168029222|-|1|ciRNA|GOLIM4|NM_001308155|10

GOLIM4

CircRNA UID

ciGOLIM4(10)

Open Reading Frame (ORF)

MMNVLINYLITLYIISEPILYNINELYAYLSAKEVVRLPR

Peptide

EVVRLPR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page