top of page

CircRNA

Gene

chr3|155828181|155833585|-|3|circRNA|SLC33A1|NM_001190992|6,5,4

SLC33A1

Open Reading Frame (ORF)

MVIMWSPLFVFSLDLVGGSFLVQNLKSYRMKDHLRGNAKGTINIYATGHSSKIIAWVRICPTGLVDS

Peptide

GTINIYATGHSSKIIAWVR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page