top of page

CircRNA

Gene

chr3|152415069|152445380|+|1|new|MBNL1|ENST00000282488|30311|0

MBNL1

Open Reading Frame (ORF)

LLAFGTVYIQNSSVRLVTGLCLPRNMLSYTLIMCAFLKKIFLY

Peptide

LVTGLCLPR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

Novel in Short-Read

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page