top of page

CircRNA

Gene

chr3|132575771|132605205|-|5|circRNA|ACAD11|ENST00000496418.5|16,15,14,13,12

ACAD11

Open Reading Frame (ORF)

MRTVGLAERALQIMCERATQRIAFKKKLYAHTQGIWRFCTCMEVRNRRNSGLSLFFKGTLPLASV

Peptide

KLYAHTQGIWR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page