top of page

CircRNA

Gene

chr3|126727077|126733222|+|3|circRNA|CHCHD6|ENST00000290913.7|2,3,4

CHCHD6

Open Reading Frame (ORF)

MNRSMLLSRISSSRWQRGKERLPPSTPRHPCPRAKAASAMRSRSQSGCCLKTW

Peptide

ERLPPSTPR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page