top of page

CircRNA

Gene

chr3|126105725|126125721|-|8|circRNA|ALDH1L1|NM_001270365|20,19,18,17,16,15,14,13

ALDH1L1

Open Reading Frame (ORF)

LDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGFVASSSPGTIP

Peptide

DLGFVASSSPGTIP

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page