top of page

CircRNA

Gene

chr3|122703741|122708268|+|3|circRNA|PARP14|ENST00000474629.6|7,8,9

PARP14

Open Reading Frame (ORF)

MLLSTPFPWISCLVEGLFLSPSWKKLDQSSRRNWTQLDKGWLSAWAQCSKPAAGIWTVAMCFTW

Peptide

MLLSTPFPWISCLVEGLFLSPSWK

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page