top of page

CircRNA

Gene

chr3|10260136|10271015|+|2|circRNA|TATDN2|ENST00000287652.8|3,4

TATDN2

Open Reading Frame (ORF)

LTLIVTWTCSIPSYLSKGPLQSSEKFTAAPSLRNFRAASLTSVIPAP

Peptide

AASLTSVIPAP

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page