top of page

CircRNA

Gene

chr22|45322370|45323427|+|2|circRNA|FAM118A|ENST00000216214.7|3,4

FAM118A

Open Reading Frame (ORF)

LASAQQWPPESLPFARGEAASRPSSRLQSSWRCCTPETSPSSGGK

Peptide

CCTPETSPSSGGK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page