top of page

CircRNA

Gene

chr22|42026765|42030823|+|3|circRNA|WBP2NL|ENST00000412113.5|5,6,7

WBP2NL

Open Reading Frame (ORF)

MEPHLLDMEPHLSDMEPHLSDMEPHLQEMKARLRDTEPHLLDQEPGLRNLQQPRLLKTRLLFPLPPLLRSILNLLRCKP

Peptide

SILNLLR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page