top of page

CircRNA

Gene

chr22|41893116|41903155|+|6|circRNA|SREBF2|ENST00000612482.4|13,14,15,16,17,18

SREBF2

Open Reading Frame (ORF)

LWGRPTTRQALNWRASNGTWAACAGWHTASAQHTARATSSAEPRACVAPSTVLFLTPCAGSATPWARSFSWSGAGL

Peptide

ASNGTWAACAGWHTASAQHTARATSSAEPR

ORF Found in Long-Read

false

Peptide Length

30

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

22

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page