top of page

CircRNA

Gene

chr22|40552105|40594735|-|2|circRNA|MKL1|ENST00000355630.7|3,2

MKL1

Open Reading Frame (ORF)

MGWTEEGPAKMMMNQCSCPYLRHPVPRVKLLPMNCRSSPCSPS

Peptide

MMMNQCSCPYLRHPVPR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page