top of page

CircRNA

Gene

chr22|33604434|33761558|-|4|circRNA|LARGE|ENST00000354992.6|6,5,4,3

LARGE

Open Reading Frame (ORF)

LDGARCACGLLQCRRAQESIMREAEDFMLRTEKRRWD

Peptide

LDGARCACGLLQCR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page