top of page

CircRNA

Gene

chr22|29560852|29561170|-|1|ciRNA|NIPSNAP1|ENST00000216121.11|7

NIPSNAP1

Open Reading Frame (ORF)

LLTCPTKAPGGPPFPGPYHRELFTFCPSWIWEKDPARR

Peptide

APGGPPFPGPYHR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page