top of page

CircRNA

Gene

chr22|24041138|24043084|+|2|circRNA|CABIN1|ENST00000263119.9|5,6

CABIN1

Open Reading Frame (ORF)

MLDSTDVNLWYKIGHVALRLIRIPLARHAFEEGLRCNPDHWPCLDNLITVLYTLSDYTSSFIR

Peptide

HAFEEGLRCNPDHWPCLDNLITVLYTLSDYTSSFIR

ORF Found in Long-Read

false

Peptide Length

36

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

32

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page