top of page

CircRNA

Gene

chr22|24035443|24043084|+|4|circRNA|CABIN1|ENST00000454754.5|2,3,4,5

CABIN1

Open Reading Frame (ORF)

MLDSTDVNLWYKIGHVALRLIRIPLARHAFEEGLRCNPDHWPCLDNLITVLYTLSDYTRELWTGATFASDEK

Peptide

ELWTGATFASDEK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page