top of page

CircRNA

Gene

chr22|23253798|23295155|+|15|circRNA|BCR|ENST00000305877.12|2,3,4,5,6,7,8,9,10,11,12,13,14,15,16

BCR

Open Reading Frame (ORF)

MKSVTTRRRSPRRTARARTDSWGRARSRWLVRNTTWIRLRCRPGRGAAPAPRWAALH

Peptide

CRPGRGAAPAPR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page