top of page

CircRNA

Gene

chr22|17477587|17505016|+|6|circRNA|CECR2|ENST00000400585.6|2,3,4,5,6,7

CECR2

Open Reading Frame (ORF)

LVAPVPDRRGMETGHREFSREDLPSRTAALQAPQ

Peptide

LVAPVPDRR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page