top of page

CircRNA

Gene

chr21|46283614|46285394|-|2|circRNA|MCM3AP|ENST00000397708.1|3,2

MCM3AP

Open Reading Frame (ORF)

LGACLPLKSQPSSARTSLTTSTTGPFWRTILAKLLKCSASLPGAAKSLQWYISLIILF

Peptide

LGACLPLKSQPSSAR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page