top of page

CircRNA

Gene

chr21|44504779|44568005|-|10|circRNA|TSPEAR|ENST00000323084.8|11,10,9,8,7,6,5,4,3,2

TSPEAR

Open Reading Frame (ORF)

LGVFLGGRRLFPGGGQLLRWAYLLGEQYYLQTCAPWTSWRKWSLLMAPQAGSG

Peptide

RLFPGGGQLLR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page