top of page

CircRNA

Gene

chr21|44052279|44087928|+|14|circRNA|TRAPPC10|ENST00000291574.8|4,5,6,7,8,9,10,11,12,13,14,15,16,17

TRAPPC10

Open Reading Frame (ORF)

LNWKFSLYLQPQHSEGRVTCWGWQSPTGSIRTNRELAAAWLPQTTKIPKCIKLQ

Peptide

VTCWGWQSPTGSIRTNR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page