top of page

CircRNA

Gene

chr21|37108391|37152029|+|16|circRNA|TTC3|ENST00000418766.5|11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26

TTC3

Open Reading Frame (ORF)

LKEDKKLKRKIQKKEAKKLAQERMEEDLRESNPPKNEEQKEMHSVMEREPLF

Peptide

NEEQKEMHSVMER

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page