top of page

CircRNA

Gene

chr21|25891721|25911962|-|4|circRNA|APP|NM_001136016|16,15,14,13

APP

Open Reading Frame (ORF)

MVGGVVIATVIVITLVMLKKKQYTSIHHGVVEMSCFRKSKTIQMTSWPT

Peptide

QYTSIHHGVVEMSCFRK

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page