top of page

CircRNA

Gene

chr20|9419806|9423952|+|3|circRNA|PLCB4|ENST00000378473.7|25,26,27

PLCB4

CircRNA UID

circPLCB4(25,26,27)

Open Reading Frame (ORF)

LARGSSRLMASKPDIDTFPFEMREINHYHYQQFSAILFLKHMCLMDLEVPSQTRFHEAA

Peptide

EINHYHYQQFSAILFLKHMCLMDLEVPSQTR

ORF Found in Long-Read

false

Peptide Length

31

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

26

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page