top of page

CircRNA

Gene

chr20|62661175|62664896|+|1|ciRNA|SLCO4A1|ENST00000217159.5|5

SLCO4A1

Open Reading Frame (ORF)

LAIVGGGCGQWVSPCCLPSTRIGGKASGPKVAPQKAPSCPRQRGAGLDEDGKERPH

Peptide

IGGKASGPK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page