top of page

CircRNA

Gene

chr20|49115781|49154071|-|10|circRNA|STAU1|ENST00000371856.6|13,12,11,10,9,8,7,6,5,4

STAU1

Open Reading Frame (ORF)

LNILKLLSELDQQSTEMPRTGNGPMSVKHNPYCRTKCTVHETWKKTNV

Peptide

LLSELDQQSTEMPRTGNGPMSVK

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

22

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page