top of page

CircRNA

Gene

chr20|38488402|38493132|+|2|circRNA|RALGAPB|NM_001282917|2,3

RALGAPB

Open Reading Frame (ORF)

MEVICYGLTLPLDGETVKYCVDVYTDWIMALVLPKDSIPLPVIKEPNQYVQTILKHLQNLFVPRCHLDCTLVARCTLSGGHCIW

Peptide

CHLDCTLVAR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page