top of page

CircRNA

Gene

chr20|37396161|37397854|+|2|circRNA|SRC|NM_005417|8,9

SRC

Open Reading Frame (ORF)

MACATASPPCAPRPSRRLRAWPRMPGRSLGSRCGWRSSWARAALARCGWVPTASQCLTSTTPRAST

Peptide

MPGRSLGSR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page