top of page

CircRNA

Gene

chr20|3578581|3604262|+|10|circRNA|ATRN|NM_001207047|15,16,17,18,19,20,21,22,23,24

ATRN

Open Reading Frame (ORF)

LEPRLEKRCLLFQKPTLRSTKIVSLMRSLIFATTQISLSLFMSVISPGPSKFRKYLWHWLAFGWKLMFENYYCQGEL

Peptide

SLIFATTQISLSLFMSVISPGPSK

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page